Sa. Mai 8th, 2021
Dirt-Torpedo1

Fuldaer Team erhält Unterstützung heimischer Netzwerke

Drei Fuldaer dual Studierende stehen in der Endrunde der von Elon Musk ausgerufenen „Not-a-boring-Competition“ zur Entwicklung und Fertigung der schnellsten Tunnel-Bohrmaschine der Welt. Sie befinden sich damit im direkten Wettbewerb mit weltbekannten Forschungseinrichtungen wie dem MIT in Boston oder der ETH Zürich. Nun geht das Projekt in die heiße Phase, denn bis zum Finalwettbewerb im Sommer wartet noch viel Arbeit auf das Team „Dirt Torpedo“. Damit das ehrgeizige Vorhaben gelingen kann, erhalten Sie seit einigen Wochen auch tatkräftige Unterstützung aus der Region.

Im vergangenen Sommer ist ein zwölfköpfiges Team der Dualen Hochschule Mosbach um drei Studenten aus der Region Fulda angetreten, um den Tunnelbau nachhaltig zu verändern und die schnellste Tunnelbohrmaschine der Welt zu entwickeln. Sie folgten damit einem weltweiten Aufruf von Tesla- und SpaceX-Gründer Elon Musk, der nach der Automobil- und Raumfahrtbranche nun auch den Tunnelbau revolutionieren möchte. Musk treibt damit die Vision Hyperloop voran, einem Hochgeschwindigkeitsverkehrssystem, bei dem sich Transportkapseln in unterirdischen Röhren mit nahezu Schallgeschwindigkeit fortbewegen.

Dirt-Torpedo2

Als eines von 12 Teams stehen die Fuldaer Adrian Fleck, Daniel Klassen und Martin Will sowie ihre neun Mitstreiter unter dem Namen „Dirt Torpedo“ kurz vor dem Finale des Wettbewerbs, das im Sommer in der Nähe von Los Angeles stattfinden wird. Dort befinden sie sich in bester Gesellschaft mit absoluten Top-Forschungseinrichtungen aus aller Welt.

Doch bis dahin noch wartet eine Menge Arbeit. „Bisher haben wir unseren Tunnelbohrer komplett virtuell entwickelt. Nun geht es darum, die Maschine auch zu konstruieren“, erklärt Teamcaptain Adrian Fleck. Angesichts des straffen Zeitplans bis zum finalen Wettkampf in der Mojave-Wüste in Kalifornien laufen die Arbeiten derweil unter Hochdruck. Dass der Bohrer tatsächlich bis zum Sommer fertiggestellt werden könne, sei keineswegs selbstverständlich. „Wir sind vor allem auf Hilfe bei der Fertigung und der Bereitstellung von Bauteilen angewiesen“, sagt Fleck, der gemeinsam mit seiner Schwester Anna bereits 2018 Sieger des Europa-Wettbewerbs von „Jugend forscht“ wurde.

Doch die Zuversicht wächst. Denn bei der Suche nach passenden Fertigungspartnern aus der Region erhielten die angehenden Ingenieure in den letzten Wochen tatkräftige Unterstützung des Fuldaer Engineering-High-Tech-Clusters. „Wir unterstützen dieses Vorzeige-Projekt sehr gerne, denn es unterstreicht die Innovationskraft und das technische Knowhow, über das wir hier in der Region verfügen. Dass im Industriepark Fulda West gegenwärtig an der schnellsten Tunnelbohrmaschine der Welt gearbeitet wird, sorgt auch für überregionale Aufmerksamkeit für unseren Standort“, sagt Cluster-Geschäftsführer Christian Vey. Ende Februar hatte das Netzwerk unter heimischen Technologieunternehmen einen Aufruf gestartet, um das Team „Dirt Torpedo“ bei der Fertigung von Bauteilen zu unterstützen. „Wir haben daraufhin viel positive Resonanz bekommen“, freut sich Adrian Fleck über die Unterstützung von heimischen Unternehmen wie FFT, Wassermann Technologie, Paul Himmelmann oder Element Six.

Damit das Projekt auch eine angemessene regionale und überregionale Aufmerksamkeit erfährt, helfen die Verantwortlichen des Fuldaer Marketing-Netzwerks bei der Öffentlichkeitsarbeit und der Sichtbarkeit im Netz. In einer Gemeinschaftsaktion haben die Agenturen Creart/Compositum, Heldenzeit und Mainblick unter der Domain www.dirt-torpedo.de eine Projektwebseite für das Team erstellt, die alle wichtigen Infos rund um das Projekt bereithält. Hier können sich auch weitere Unternehmen und Organisationen melden, die das Team unterstützen möchten. Neben finanzieller Zuwendung für die Anschaffung von dringend benötigtem Equipment, freuen sich die Tunnel-Pioniere auch über Unterstützung bei der Logistik für den Transport der Maschine in die USA.

Bis zum Finale im Sommer wird auch über die Social-Media-Kanäle der Region Fulda GmbH sowie den Dirt-Torpedo Instagram-Auftritt regelmäßig über das Projekt berichtet.

www.facebook.com/RegionFulda/
www.linkedin.com/company/regionfulda
www.instagram.com/thedirttorpedo

Kontakt:

Region Fulda GmbH
Esperantostraße 3
36037 Fulda

Von Thomas